PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000190.1.g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GRAS
Protein Properties Length: 361aa    MW: 40751.1 Da    PI: 8.0387
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000190.1.g00006.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS46.18e-1512018895163
                            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetge 163
                                      ++  qaI+e+v++++rvH iD++i  G++   L+qaLasR e+p  +l++T+vg+  ++s+++le tg+
  FANhyb_rscf00000190.1.g00006.1 120 KFAGIQAIVESVASAKRVHFIDLEIRSGGHCTVLMQALASRYEQPIeMLKVTAVGN-GTSSRQKLEDTGK 188
                                     67778************************************9666559********.5568999999886 PP

2GRAS104.41.6e-32194348220374
                            GRAS 220 leserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                                     l+++ ++ + ++++l+P ++v++e ea++ s+ F +rf eal yy a +d+l++ + + s  r+ +E+ +l+++i+n++
  FANhyb_rscf00000190.1.g00006.1 194 LPDCLETAITALRKLNPCLMVITETEANLYSPVFEDRFNEALFYYGAYYDCLDVCMDSCSPYRRELEETFLAQQIKNII 272
                                     5667788999********************************************************************* PP

                            GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                     a e++ r+ rh +   Wr+ + ++G+ +++ls +   qa+l  ++++ ++  +++ + ++l+ gWk+ p++s+SaW+
  FANhyb_rscf00000190.1.g00006.1 273 ASEEE-RIFRHMRIDVWRSLFAKFGMVEAELSLSSLYQADLTAKQFAcGKSCTLNMNGKCLTVGWKGTPILSLSAWK 348
                                     *9987.7****************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098512.8271327IPR005202Transcription factor GRAS
PfamPF035142.8E-12120188IPR005202Transcription factor GRAS
PfamPF035145.4E-30194348IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MSSVSRLSTV EVMRVARARF IQFSYQKYAD DSIPNHVLGC APLGLSDQDA KEVELAHLLL  60
AFADKVGKQQ YDQAENCRIY AISYLPALEI LFRELFIIFQ KLFKRGQIGK LGESHIRAQK  120
FAGIQAIVES VASAKRVHFI DLEIRSGGHC TVLMQALASR YEQPIEMLKV TAVGNGTSSR  180
QKLEDTGKSS VRSLPDCLET AITALRKLNP CLMVITETEA NLYSPVFEDR FNEALFYYGA  240
YYDCLDVCMD SCSPYRRELE ETFLAQQIKN IIASEEERIF RHMRIDVWRS LFAKFGMVEA  300
ELSLSSLYQA DLTAKQFACG KSCTLNMNGK CLTVGWKGTP ILSLSAWKFH AVNTKTSKYL  360
M
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308535.10.0PREDICTED: DELLA protein GAI1-like
TrEMBLM5Y8021e-126M5Y802_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s15330.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.19e-29RGA-like 2